missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Annexin A10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-16992-100UL
Additional Details : Weight : 0.00970kg
Description
Annexin A10 Polyclonal antibody specifically detects Annexin A10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Annexin A10 | |
| Polyclonal | |
| Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| annexin 14, annexin A10, annexin-10, annexin-14, ANX14Annexin-10 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGDLREQLSDHFKDVMAG | |
| 100 μg | |
| Signal Transduction | |
| 11199 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |