missing translation for 'onlineSavingsMsg'
Learn More

Aly Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10855-100UL

Additional Details : Weight : 0.00970kg

Product Code. 18331494

Estimated Shipment: 26-08-2024
to see stock.

Description

Aly Polyclonal specifically detects Aly in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	Aly
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	Ally of AML-1 and LEF-1, ALY/REF, ALYBEFbZIP enhancing factor, bZIP-enhancing factor BEF, REF, THO complex 4, THO complex subunit 4, tho4, Transcriptional coactivator Aly/REF
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of mouse REFBP2 (NP_062357.3). Peptide sequence KMDMSLDDIIKLNRNQRRVNRGGGPRRNRPAIARGGRNRPAPYSRPKPLP
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Mouse
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	10189
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description