missing translation for 'onlineSavingsMsg'
Learn More

Aly Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10855-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18331494

  • 449.23 EUR / 100µL
Estimated Shipment: 12-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Aly Polyclonal specifically detects Aly in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

Aly
Polyclonal
Western Blot 1.0 ug/ml
Ally of AML-1 and LEF-1, ALY/REF, ALYBEFbZIP enhancing factor, bZIP-enhancing factor BEF, REF, THO complex 4, THO complex subunit 4, tho4, Transcriptional coactivator Aly/REF
The immunogen is a synthetic peptide directed towards the N terminal region of mouse REFBP2 (NP_062357.3). Peptide sequence KMDMSLDDIIKLNRNQRRVNRGGGPRRNRPAIARGGRNRPAPYSRPKPLP
100 μg
Primary
Mouse
Purified
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
10189
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers