missing translation for 'onlineSavingsMsg'
Learn More

Syndecan-2/CD362 Antibody (1B2), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00006383-M04

Additional Details : Weight : 0.00970kg

Product Code. 18331529

  • 584.22 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Syndecan-2/CD362 Monoclonal antibody specifically detects Syndecan-2/CD362 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications

Specifications

Syndecan-2/CD362
Monoclonal
Unconjugated
NP_002989
Mouse
Protein A purified
RUO
Primary
Human
Purified
Western Blot, ELISA, Sandwich ELISA
1B2
In 1x PBS, pH 7.4
CD362 antigen, fibroglycan, heparan sulfate proteoglycan 1, cell surface-associated, Heparan sulfate proteoglycan core protein, HSPG, HSPG1syndecan proteoglycan 2, SYND2cell surface-associated heparan sulfate proteoglycan 1, syndecan 2, syndecan-2
SDC2 (NP_002989.2, 32 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNV
0.1 mg
Extracellular Matrix
6383
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG2a κ
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers