missing translation for 'onlineSavingsMsg'
Learn More

RhoA Antibody (1A11), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00000387-M03

Additional Details : Weight : 0.00970kg

Product Code. 18331618

  • 590.70 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

RhoA Monoclonal antibody specifically detects RhoA in Human samples. It is validated for Western Blot, ELISA
Specifications

Specifications

RhoA
Monoclonal
Unconjugated
In 1x PBS, pH 7.4
h12, oncogene RHO H12, ras homolog gene family, member A, Rho cDNA clone 12, Rho12, RhoA, RHOH12ARH12ARHAAplysia ras-related homolog 12, small GTP binding protein RhoA, transforming protein RhoA
RHOA (AAH01360, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
0.1 mg
mTOR Pathway, Signal Transduction, Wnt Signaling Pathway
387
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG1 λ
Western Blot, ELISA
1A11
Western Blot 1:500
AAH01360
Mouse
IgG purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers