missing translation for 'onlineSavingsMsg'
Learn More

NDUFA5 Antibody (4A2), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00004698-M02

Additional Details : Weight : 0.00970kg

Product Code. 18331378

  • 590.70 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

NDUFA5 Monoclonal antibody specifically detects NDUFA5 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA
Specifications

Specifications

NDUFA5
Monoclonal
Unconjugated
NP_004991
Mouse
IgG purified
RUO
Primary
Human
Purified
Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
4A2
In 1x PBS, pH 7.4
B13,5 (13kD, B13), DKFZp781K1356, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa, UQOR13FLJ12147
NDUFA5 (NP_004991.1, 1 a.a. ~ 116 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
0.1 mg
Cancer, Endocrinology, Neurodegeneration, Neuroscience
4698
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG1 κ
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers