missing translation for 'onlineSavingsMsg'
Learn More

MTAP Antibody (4C8), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00004507-M08

Additional Details : Weight : 0.00970kg

Product Code. 18331558

  • 584.22 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

MTAP Monoclonal antibody specifically detects MTAP in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications

Specifications

MTAP
Monoclonal
Unconjugated
In 1x PBS, pH 7.4
5'-methylthioadenosine phosphorylase, c86fus, EC 2.4.2.28, methylthioadenosine phosphorylase, MSAPMeSAdo phosphorylase, MTA phosphorylase, MTAPase, S-methyl-5'-thioadenosine phosphorylase
MTAP (AAH26106, 1 a.a. ~ 283 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
0.1 mg
Primary
Human
Purified
Western Blot, ELISA, Sandwich ELISA
4C8
Western Blot 1:500
AAH26106
Mouse
IgG purified
RUO
4507
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG2a κ
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers