missing translation for 'onlineSavingsMsg'
Learn More

DBPA Antibody (1H5), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00008531-M06

Additional Details : Weight : 0.00970kg

Product Code. 18331249

  • 606.90 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

DBPA Monoclonal antibody specifically detects DBPA in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications

Specifications

DBPA
Monoclonal
Unconjugated
NP_003642
Mouse
IgG purified
RUO
8531
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG2a κ
Western Blot, ELISA, Immunocytochemistry
1H5
In 1x PBS, pH 7.4
cold shock domain protein A, Cold shock domain-containing protein A, cold-shock domain protein A, CSDA1, dbpA, DBPAcold-shock domain containing A1, DNA-binding protein A, Single-strand DNA-binding protein NF-GMB, ZO-1-associated nucleic acid-binding protein, ZONAB
CSDA (NP_003642, 241 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYR
0.1 mg
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers