missing translation for 'onlineSavingsMsg'
Learn More

FGL2/Fibroleukin Antibody (6D9), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00010875-M01

Additional Details : Weight : 0.00970kg

Product Code. 18331689

  • 613.37 EUR / 0.01mg
Estimated Shipment: 04-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

FGL2/Fibroleukin Monoclonal antibody specifically detects FGL2/Fibroleukin in Human, Mouse, Rat samples. It is validated for Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), Functional Assay
Specifications

Specifications

FGL2/Fibroleukin
Monoclonal
Unconjugated
In 1x PBS, pH 7.4
fibrinogen-like 2, Fibrinogen-like protein 2, fibroleukin, pT49T49
FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
0.1 mg
Cancer
10875
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG2a κ
Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), Functional Assay
6D9
Western Blot 1:500, Flow Cytometry, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 0.5μg/mL, Functional
NP_006673
Mouse
Protein A purified
RUO
Primary
Human, Mouse, Rat
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers