missing translation for 'onlineSavingsMsg'
Learn More

Creatine kinase MT 1B Antibody (2C9), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00001159-M16

Additional Details : Weight : 0.00970kg

Product Code. 18331608

  • 584.22 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Creatine kinase MT 1B Monoclonal antibody specifically detects Creatine kinase MT 1B in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications

Specifications

Creatine kinase MT 1B
Monoclonal
Unconjugated
NP_066270
Mouse
Protein A purified
RUO
Primary
Human
Purified
Western Blot, ELISA, Sandwich ELISA
2C9
In 1x PBS, pH 7.4
Acidic-Type Mitochondrial Creatine Kinase, CKMT, CKMT1, CKMT1B, Creatine Kinase U-Type, Mitochondrial, Creatine Kinase, Mitochondrial 1 (Ubiquitous), Creatine Kinase, Mitochondrial 1B, EC 2.7.3.2, Mia-CK, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, UMTCK
CKMT1B (NP_066270, 327 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
0.1 mg
Stem Cell Markers
1159
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG1 κ
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers