missing translation for 'onlineSavingsMsg'
Learn More

CDKL5 Antibody (1D9), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00006792-M01

Additional Details : Weight : 0.00970kg

Product Code. 18331509

  • 584.22 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

CDKL5 Monoclonal antibody specifically detects CDKL5 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications

Specifications

CDKL5
Monoclonal
Unconjugated
cyclin-dependent kinase-like 5, serine/threonine kinase 9, serine/threonine-protein kinase 9
CDKL5 (AAH36091, 722 a.a. ~ 831 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQT
0.1 mg
Protein Kinase
6792
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG1 κ
Western Blot, ELISA, Sandwich ELISA
1D9
In 1x PBS, pH 7.4
Mouse
IgG purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers