missing translation for 'onlineSavingsMsg'
Learn More

CDK8 Antibody (6E5), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals H00001024-M02

Additional Details : Weight : 0.00970kg

Product Code. 18331508

Estimated Shipment: 26-08-2024
to see stock.

Description

CDK8 Monoclonal antibody specifically detects CDK8 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, ELISA

Specifications

Antigen	CDK8
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	In 1x PBS, pH 7.4
Gene Alias	CDK8 protein kinase, Cell division protein kinase 8, cyclin-dependent kinase 8, EC 2.7.11, EC 2.7.11.22, EC 2.7.11.23, K35, Mediator complex subunit CDK8, Mediator of RNA polymerase II transcription subunit CDK8, MGC126074, MGC126075, Protein kinase K35
Immunogen	CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Quantity	0.1 mg
Research Discipline	Cell Cycle and Replication
Gene ID (Entrez)	1024
Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Isotype	IgG1 κ

Applications	Western Blot, ELISA, Sandwich ELISA
Clone	6E5
Dilution	Western Blot 1:500
Gene Accession No.	NP_001251
Host Species	Mouse
Purification Method	IgG purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Form	Purified

Product Suggestions

Description