missing translation for 'onlineSavingsMsg'
Learn More

CDK8 Antibody (6E5), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00001024-M02

Additional Details : Weight : 0.00970kg

Product Code. 18331508

  • 584.22 EUR / 0.01mg
Estimated Shipment: 18-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

CDK8 Monoclonal antibody specifically detects CDK8 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, ELISA
Specifications

Specifications

CDK8
Monoclonal
Unconjugated
In 1x PBS, pH 7.4
CDK8 protein kinase, Cell division protein kinase 8, cyclin-dependent kinase 8, EC 2.7.11, EC 2.7.11.22, EC 2.7.11.23, K35, Mediator complex subunit CDK8, Mediator of RNA polymerase II transcription subunit CDK8, MGC126074, MGC126075, Protein kinase K35
CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
0.1 mg
Cell Cycle and Replication
1024
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
IgG1 κ
Western Blot, ELISA, Sandwich ELISA
6E5
Western Blot 1:500
NP_001251
Mouse
IgG purified
RUO
Primary
Human, Mouse, Rat
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers