accessibility menu, dialog, popup

UserName

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (6,385)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

centrifuges

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

special offers

  • (138)

brands

  • (1)
  • (8)
  • (6,374)
  • (1)
  • (1)

special programs

  • (6)

Applications

  • (3)
  • (9)
  • (10)
  • (2)
  • (32)
  • (56)
  • (1)
Show all

Classification

  • (791)
  • (5,591)
  • (2)

Conjugate

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Host Species

  • (2)
  • (17)
  • (3)
  • (2)
  • (755)
  • (5,600)
  • (5)

Quantity

  • (9)
  • (9)
  • (5)
  • (1)
  • (5)
  • (109)
  • (28)
Show all

Target Species

  • (1)
  • (5)
  • (1)
  • (1)
  • (4,273)
  • (4,217)
  • (5)
Show all

Regulatory Status

  • (6,382)

Isotype

  • (5,560)
  • (31)
  • (497)
  • (4)
  • (2)
  • (2)
  • (128)
Show all

Form

  • (50)
  • (9)
  • (14)
  • (1,441)
1 – 15 of 6,371 results
1

Invitrogen™ La Crosse Virus Monoclonal Antibody (8C2.2)
GREENER_CHOICE

Mouse Monoclonal Antibody

2

Invitrogen™ La Crosse Virus Monoclonal Antibody (10G5.4)
GREENER_CHOICE

Mouse Monoclonal Antibody

3

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

4

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

5

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

6

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

10

SLC22A10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_001034841
Antigen SLC22A10
Gene Symbols SLC22A10
Regulatory Status RUO
Gene Alias member 10, solute carrier family 22, member 10
Gene ID (Entrez) 387775
Immunogen Synthetic peptide directed towards the middle region of human SLC22A10. Peptide sequence QTLRVALACLGIGCSAATFSSVAVHFIELIPTVLRARASGIDLTASRIGA.
Classification Polyclonal
Primary or Secondary Primary
11

ZNF597 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_689670
Antigen ZNF597
Gene Symbols ZNF597
Regulatory Status RUO
Molecular Weight of Antigen 48 kDa
Gene Alias FLJ33071, zinc finger protein 597
Gene ID (Entrez) 146434
Immunogen Synthetic peptide directed towards the middle region of human ZNF597. Peptide sequence: GLAQHQKSHSAENTYESTNCDKHFNEKPNLALPEETFVSGPQYQHTKCMK
Classification Polyclonal
Primary or Secondary Primary
12

ZNF491 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_689569
Antigen ZNF491
Gene Symbols ZNF491
Regulatory Status RUO
Molecular Weight of Antigen 51 kDa
Gene Alias FLJ34791, MGC126639, zinc finger protein 491
Gene ID (Entrez) 126069
Immunogen Synthetic peptide directed towards the N terminal of human ZNF491. Peptide Sequence: SFNRNIRTDTGHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTRE
Classification Polyclonal
Primary or Secondary Primary
13

ZNF680 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_848653
Antigen ZNF680
Gene Symbols ZNF680
Regulatory Status RUO
Molecular Weight of Antigen 62 kDa
Gene Alias FLJ90430, zinc finger protein 680
Gene ID (Entrez) 340252
Immunogen Synthetic peptide directed towards the N terminal of human ZNF680. Peptide sequence: RGYGKCGHENLQLRISCKSVDESKVFKEGYNELNQCLRTTQSKIFQCDKY
Classification Polyclonal
Primary or Secondary Primary
14

ZNF778 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Gene Accession No. NP_872337
Antigen ZNF778
Gene Symbols ZNF778
Regulatory Status RUO
Purification Method Protein A purified
Molecular Weight of Antigen 49 kDa
Gene Alias FLJ31875, MGC150573, zinc finger protein 778
Gene ID (Entrez) 197320
Immunogen Synthetic peptide directed towards the middle region of human FLJ31875. Peptide sequence AFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHTREKPFA.
Classification Polyclonal
Primary or Secondary Primary
15

ZNF879 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Antigen ZNF879
Gene Symbols ZNF879
Regulatory Status RUO
Molecular Weight of Antigen 77 kDa
Gene Alias zinc finger protein 879
Gene ID (Entrez) 345462
Immunogen Synthetic peptide directed towards the N terminal of human DKFZp686E2433. Peptide sequence: MKSGGTNAGGSARETRRLSGAQAQLRPAATGNVSELGVPLASCAVWSCAP
Classification Polyclonal
Primary or Secondary Primary